file:///E:/X-ray%20crystallography%20-%20Wikipedia,%20the%20free%20encyclopedia.htm
file:///E:/Protein%20nuclear%20magnetic%20resonance%20spectroscopy%20-%20Wikipedia,%20the%20free%20encyclopedia.htm
Friday, September 11, 2009
NMR spectroscopy
Protein nuclear magnetic resonance spectroscopy
From Wikipedia, the free encyclopedia
(Redirected from Protein NMR)
Jump to: navigation, search
Pacific Northwest National Laboratory's high magnetic field (800 MHz) NMR spectrometer being loaded with a sample.
Protein nuclear magnetic resonance spectroscopy (usually abbreviated protein NMR) is a field of structural biology in which NMR spectroscopy is used to obtain information about the structure and dynamics of proteins. The field was pioneered by, among others, Kurt Wüthrich, who shared the Nobel Prize in Chemistry in 2002. Protein NMR techniques are continually being used and improved in both academia and the biotech industry. Structure determination by NMR spectroscopy usually consists of several following phases, each using a separate set of highly specialized techniques. The sample is prepared, resonances are assigned, restraints are generated and a structure is calculated and validated.
Contents[hide]
1 Sample preparation
2 Data collection
3 Resonance assignment
3.1 Homonuclear nuclear magnetic resonance
3.2 Nitrogen-15 nuclear magnetic resonance
3.3 Carbon-13 and nitrogen-15 nuclear magnetic resonance
4 Restraint generation
4.1 Distance restraints
4.2 Angle restraints
4.3 Orientation restraints
5 Hydrogen-Deuterium exchange
6 Structure calculation
7 Dynamics
8 NMR spectroscopy on large proteins
9 Automation of the process
10 See also
11 References
11.1 Citations
11.2 General references
11.3 Related links
//
[edit] Sample preparation
The NMR sample is prepared in a thin walled glass tube.
Protein nuclear magnetic resonance is performed on aqueous samples of highly purified protein. Usually the sample consist of between 300 and 600 microlitres with a protein concentration in the range 0.1 – 3 millimolar. The source of the protein can be either natural or produced in an expression system using recombinant DNA techniques through genetic engineering. Recombinantly expressed proteins are usually easier to produce in sufficient quantity, and makes isotopic labelling possible.
The most abundant isotopes of carbon and oxygen, carbon-12 and oxygen-16, have no net nuclear spin, which is the physical property nuclear magnetic resonance spectroscopy exploits. The most abundant isotope of nitrogen, nitrogen-14, has a net nuclear spin of 1; however, it also has a large quadrupolar moment, a property of the atomic nuclei which prevents high-resolution information to be obtained from this isotope. Thus nuclear magnetic resonance of proteins from natural sources is restricted to utilizing nuclear magnetic resonance based solely on protons. However the less common isotopes, carbon-13 and nitrogen-15, have a net nuclear spin of 1/2, a simpler case making them suitable for nuclear magnetic resonance, and therefore labeling the proteins with these compounds opens up possibilities for doing more advanced experiments which also detect or use these nuclei. Isotopic labeling is done by growing the expression host in a growth media enriched with the desired isotopes. Since isotopically-enriched compounds remain expensive, organisms are used which are capable of growing on a defined minimal medium, containing only one carbon-13 source, usually glucose, but occasionally glycerol or methanol, and one nitrogen-15 source such as ammonium chloride or ammonium sulfate . These organisms include organisms such as Escherichia coli, which is the most frequently used type of bacteria, and Pichia pastoris, which is the most frequently used yeast.
The purified protein is usually dissolved in a buffer solution and adjusted to the desired solvent conditions. The NMR sample is prepared in a thin walled glass tube.
[edit] Data collection
Protein NMR utilizes multidimensional nuclear magnetic resonance experiments to obtain information about the protein. Ideally, each distinct nucleus in the molecule experiences a distinct chemical environment and thus has a distinct chemical shift by which it can be recognized. However, in large molecules such as proteins the number of resonances can typically be several thousand and a one-dimensional spectrum inevitably has incidental overlaps. Therefore multidimensional experiments are performed which correlate the frequencies of distinct nuclei. The additional dimensions decrease the chance of overlap and have a larger information content since they correlate signals from nuclei within a specific part of the molecule. Magnetization is transferred into the sample using pulses of electromagnetic (radiofrequency) energy and between nuclei using delays; the process is described with so-called pulse sequences. Pulse sequences allow the experimenter to investigate and select specific types of connections between nuclei. The array of nuclear magnetic resonance experiments used on proteins fall in two main categories — one where magnetization is transferred through the chemical bonds, and one where the transfer is through space, irrespective of the bonding structure. The first category is used to assign the different chemical shifts to a specific nucleus, and the second is primarily used to generate the distance restraints used in the structure calculation, and in the assignment with unlabelled protein.
Depending on the concentration of the sample, on the magnetic field of the spectrometer, and on the type of experiment, a single multidimensional nuclear magnetic resonance experiment on a protein sample may take hours or even several days to obtain suitable signal-to-noise ratio through signal averaging, and to allow for sufficient evolution of magnetization transfer through the various dimensions of the experiment. Other things being equal, higher-dimensional experiments will take longer than lower-dimensional experiments.
Typically the first experiment to be measured with an isotope-labelled protein is a 2D heteronuclear single quantum correlation (HSQC) spectrum where "heteronuclear" refers to nuclei other than 1H. In theory the heteronuclear single quantum correlation has one peak for each H bound to a heteronucleus. Thus in the 15N-HSQC one signal is expected for each amino acid residue with the exception of proline which has no amide-hydrogen due to the cyclic nature of its backbone. Tryptophan and certain other residues with N-containing sidechains also give rise to additional signals. The 15N-HSQC is often referred to as the fingerprint of a protein because each protein has a unique pattern of signal positions. Analysis of the 15N-HSQC allows researchers to evaluate whether the expected number of peaks is present and thus to identify possible problems due to multiple conformations or sample heterogeneity. The relatively quick heteronuclear single quantum correlation experiment helps determine the feasibility of doing subsequent longer, more expensive, and more elaborate experiments. It is not possible to assign peaks to specific atoms from the heteronuclear single quantum correlation alone.
[edit] Resonance assignment
In order to analyze the nuclear magnetic resonance data, it is important to get a resonance assignment for the protein. That is to find out which chemical shift in each dimension corresponds to which atom. Several different types of experiments have been invented to achieve this. The procedure depends on whether the protein is isotopically labelled or not, since a lot of the assignment experiments depend on carbon-13 and nitrogen-15.
Comparison of a COSY and TOCSY 2D spectra for an amino acid like glutamate or methionine. The TOCSY shows off diagonal crosspeaks between all protons in the spectrum, but the COSY only has crosspeaks between neighbours.
[edit] Homonuclear nuclear magnetic resonance
With unlabelled protein the usual procedure is to record a set of two dimensional homonuclear nuclear magnetic resonance experiments through correlation spectroscopy (COSY), of which several types include conventional correlation spectroscopy, total correlation spectroscopy (TOCSY) and nuclear Overhauser effect spectroscopy (NOESY).[1] A two-dimensional nuclear magnetic resonance experiment produces a two-dimensional spectrum. The units of both axes are chemical shifts. The COSY and TOCSY transfer magnetization through the chemical bonds between adjacent protons. The conventional correlation spectroscopy experiment is only able to transfer magnetization between protons on adjacent atoms, whereas in the total correlation spectroscopy experiment the protons are able to relay the magnetization, so it is transferred among all the protons that are connected by adjacent atoms. Thus in a conventional correlation spectroscopy, an alpha proton transfers magnetization to the beta protons, the beta protons transfers to the alpha and gamma protons, if any are present, then the gamma proton transfers to the beta and the delta protons, and the process continues. In total correlation spectroscopy, the alpha and all the other protons are able to transfer magnetization to the beta, gamma, delta, epsilon if they are connected by a continuous chain of protons. The continuous chain of protons are the sidechain of the individual amino acids. Thus these two experiments are used to build so called spin systems, that is build a list of resonances of the chemical shift of the peptide proton, the alpha protons and all the protons from each residue’s sidechain. Which chemical shifts corresponds to which nuclei in the spin system is determined by the conventional correlation spectroscopy connectivities and the fact that different types of protons have characteristic chemical shifts. To connect the different spinsystems in a sequential order, the nuclear Overhauser effect spectroscopy experiment has to be used. Because this experiment transfers magnetization through space, it will show crosspeaks for all protons that are close in space regardless of whether they are in the same spin system or not. The neighbouring residues are inherently close in space, so the assignments can be made by the peaks in the NOESY with other spin systems.
One important problem using homonuclear nuclear magnetic resonance is overlap between peaks. This occurs when different protons have the same or very similar chemical shifts. This problem becomes greater as the protein becomes larger, so homonuclear nuclear magnetic resonance is usually restricted to small proteins or peptides.
[edit] Nitrogen-15 nuclear magnetic resonance
Schematic of an HNCA and HNCOCA for four sequential residues. The nitrogen-15 dimension is perpendicular to the screen. Each window is focused on the nitrogen chemical shift of that amino acid. The sequential assignment is made by matching the alpha carbon chemical shifts. In the HNCA each residue sees the alpha carbon of it self and the preceding residue. The HNCOCA only sees the alpha carbon of the preceding residue.
The process of resonance assignment for a nitrogen-15 labelled sample is similar to the homonuclear case. No experiment can be performed that transfers magnetisation between two spin systems through bonds either. The main difference is the ability to record nitrogen-15 edited three dimensional experiments: TOCSY-N HSQC and NOESY-N-HSQC. These experiments build onto the HSQC experiment, but have an additional proton dimension. It can be visualised as each peak in the HSQC having the TOCSY or NOESY peaks stacked onto it. Thus if the TOCSY peak from an amide proton, HN, has a cross peak to its alpha proton, Halpha, at the coordinates (HN, Halpha) in the TOCSY spectrum, the corresponding peak would be at (HN, Halpha,N) in the TOCSY-N-HSQC. Thus it is possible to resolve overlaps in the proton dimension, if the corresponding nitrogens have chemical shifts distinct from one another.
[edit] Carbon-13 and nitrogen-15 nuclear magnetic resonance
When the protein is labelled with carbon-13 and nitrogen-15 it is possible to record an experiment that transfers magnetisation over the peptide bond, and thus connect different spin systems through bonds. This is usually done using some of the following experiments, HNCO, HNCACO, HNCA,[2] HNCOCA, HNCACB and CBCACONH. All six experiments consist of a HSQC plane expanded with a carbon dimension. In the HNCACO the spectrum contains peaks at the chemical shifts of the carbonyl carbons in the residue of the HSQC peak and the previous one in the sequence. The HNCO only contains the chemical shift from the previous residue, and it is thus possible to assign the carbonyl carbon shifts that corresponds to each HSQC peak and the one previous to that one. Sequential assignment can then be undertaken by matching the shifts of each spin system's own and previous carbons. The HNCA and HNCOCA works similarly, just with the alpha carbons rather than the carbonyls, and the HNCACB and the CBCACONH contains both the alpha carbon and the beta carbon. Usually several of these experiments are required to resolve overlap in the carbon dimension. This procedure is usually less ambiguous than the NOESY based method, since it is based on through bond transfer. In the NOESY-based methods additional peaks that are close in space but not belonging to the sequential residues will appear confusing the assignment process. When the sequential assignment has been made it is usually possible to assign the sidechains using HCCH-TOCSY, which is basically a TOCSY experiment resolved in an additional carbon dimension.
[edit] Restraint generation
In order to make structure calculations a number of experimentially determined restraints have to be generated. These fall into different categories, the most widely used is distance restraints and angle restraints.
[edit] Distance restraints
A crosspeak in a NOESY experiment signifies spatial proximity between the two nuclei in question. Thus each peak can be converted in to a maximum distance between the nuclei, usually between 1,8 and 6 angstroms. The intensity of a noesy peak is proportional to the distance to the minus 6th power, so the distance is determined according to intensity of the peak. The intensity-distance relationship is not exact, so usually a distance range is used.
It is of great importance to assign the noesy peaks to the correct nuclei based on the chemical shifts. If this task is performed manually it is usually very labor intensive, since proteins usually have thousands of noesy peaks. Some computer programs such as CYANA[3] and ARIA[4]/CNS perform this task automatically, coupled to a structure calculation.
To obtain as accurate assignments as possible it is a great advantage to have access to carbon-13 and nitrogen-15 noesy experiments, since they help to resolve overlap in the proton dimension. This leads to faster and more reliable assignments, and in turn to better structures.
[edit] Angle restraints
In addition to distance restraints, restraints on the torsion angles of the chemical bonds, typically the psi and phi angles can be generated. One approach is to use the Karplus equation, to generate angle restraints from coupling constants. Another approach uses the chemical shifts to generate angle restraints. Both methods use the fact that the geometry around the alpha carbon affects the coupling constants and chemical shifts, so given the coupling constants or the chemical shifts, a qualified guess can be made about the torsion angles.
[edit] Orientation restraints
Main article: Residual dipolar coupling
The blue arrows represent the orientation of the N - H bond of selected peptide bonds. By determining the orientation of a sufficient amount of bonds relative to the external magnetic field, the structure of the protein can be determined. From PDB record 1KBH
The analyte molecules in a sample can be partially ordered with respect to the external magnetic field of the spectrometer by manipulating the sample conditions. Common techniques include addition of bacteriophages or bicelles to the sample, or preparation of the sample in a stretched polyacrylamide gel. This creates a local environment that favours certain orientations of nonspherical molecules. Normally in solution NMR the dipolar couplings between nuclei are averaged out because of the fast tumbling of the molecule. The slight overpopulation of one orientation means that a residual dipolar coupling remains to be observed. The dipolar coupling is commonly used in solid state NMR and provides information about the relative orientation of the bond vectors relative to a single global reference frame. Typically the orientation of the N-H vector is probed in a HSQC like experiment. Initially residual dipolar couplings were used for refinement of previously determined structures, but attempts at de novo structure determination have also been made.[5]
[edit] Hydrogen-Deuterium exchange
Main article: Hydrogen-deuterium exchange
NMR spectroscopy is nuclei specific. Thus it can distinguish between hydrogen and deuterium. The amide protons in the protein exchange readily with the solvent, and if the solvent contains a different isotope, typically deuterium, the reaction can be monitored by NMR spectroscopy. How rapidly a given amide exchanges reflects its solvent accessibility. Thus amide exchange rates can give information on which parts of the protein are buried, hydrogen bonded etc. A common application is to compare the exchange of a free form versus a complex. The amides that become protected in the complex, are assumed to be in the interaction interface.
[edit] Structure calculation
Nuclear magnetic resonance structure determination generates an ensemble of structures. The structures will only converge if the data is sufficient to dictate a specific fold. In these structures, it is only the case for a part of the structure. From PDB 1SSU.
The experimentially determined restraints can be used as input for the structure calculation process. Researchers, using computer programs such as CYANA or XPLOR-NIH,[6] attempt to satisfy as many of the restraints as possible, in addition to general properties of proteins such as bond lengths and angles. The algorithms convert the restraints and the general protein properties into energy terms, and thus tries to minimize the energy. The process results in an ensemble of structures that, if the data were sufficient to dictate a certain fold, will converge.
[edit] Dynamics
In addition to structures, nuclear magnetic resonance can yield information on the dynamics of various parts of the protein. This usually involves measuring relaxation times such as T1 and T2 to determine order parameters, correlation times, and chemical exchange rates. NMR relaxation is a consequence of local fluctuating magnetic fields within a molecule. Local fluctuating magnetic fields are generated by molecular motions. In this way measurements of relaxation times can provide information of motions within a molecule on the atomic level. In NMR studies of protein dynamics the nitrogen-15 isotope is the preferred nucleus to study, because its relaxation times are relatively simple to relate to molecular motions, which however requires isotope labeling of the protein. The T1 and T2 relaxation times can be measured using various types of HSQC based experiments. The types of motions, which can be detected, are motions that occur on a time-scale ranging from about 10 picoseconds to about 10 nanoseconds. In addition slower motions, which take place on a time-scale ranging from about 10 microseconds to 100 milliseconds can also be studied. However, since nitrogen atoms are mainly found in the backbone of a protein, the results mainly reflect the motions of the backbone, which is the most rigid part of a protein molecule. Thus, the results obtained from nitrogen-15 relaxation measurements may not be representative for the whole protein. Therefore techniques utilizing relaxation measurements of carbon-13 and deuterium have recently been developed, which enables systematic studies of motions of the amino acid side chains in proteins.
[edit] NMR spectroscopy on large proteins
Traditionally nuclear magnetic resonance spectroscopy has been limited to relatively small proteins or protein domains. This is in part caused by problems resolving overlapping peaks in larger proteins, but this has been alleviated by the introduction of isotope labelling and multidimensional experiments. Another more serious problem is the fact that in large proteins the magnetization relaxes faster, which means there is less time to detect the signal. This in turn causes the peaks to become broader and weaker, and eventually disappear. Two techniques have been introduced to attenuate the relaxation: transverse relaxation optimized spectroscopy (TROSY)[7] and deuteration[8] of proteins. By using these techniques it has been possible to study proteins in complex with the 900 kDa chaperone GroES-GroEL.[9]
[edit] Automation of the process
Structure determination by NMR has traditionally been a time consuming process, requiring interactive analysis of the data by a trained scientist. There has been a considerable interest in automating the process to increase the throughput of structure determination (See structural genomics). The two most time consuming processes are the resonance assignment and the NOE assignment. Several different computer programs have been published that do this processes automatically.[3][1] Efforts have also been made to standardize the structure calculation protocol to make it quicker and more amenable to automation.[10]
From Wikipedia, the free encyclopedia
(Redirected from Protein NMR)
Jump to: navigation, search
Pacific Northwest National Laboratory's high magnetic field (800 MHz) NMR spectrometer being loaded with a sample.
Protein nuclear magnetic resonance spectroscopy (usually abbreviated protein NMR) is a field of structural biology in which NMR spectroscopy is used to obtain information about the structure and dynamics of proteins. The field was pioneered by, among others, Kurt Wüthrich, who shared the Nobel Prize in Chemistry in 2002. Protein NMR techniques are continually being used and improved in both academia and the biotech industry. Structure determination by NMR spectroscopy usually consists of several following phases, each using a separate set of highly specialized techniques. The sample is prepared, resonances are assigned, restraints are generated and a structure is calculated and validated.
Contents[hide]
1 Sample preparation
2 Data collection
3 Resonance assignment
3.1 Homonuclear nuclear magnetic resonance
3.2 Nitrogen-15 nuclear magnetic resonance
3.3 Carbon-13 and nitrogen-15 nuclear magnetic resonance
4 Restraint generation
4.1 Distance restraints
4.2 Angle restraints
4.3 Orientation restraints
5 Hydrogen-Deuterium exchange
6 Structure calculation
7 Dynamics
8 NMR spectroscopy on large proteins
9 Automation of the process
10 See also
11 References
11.1 Citations
11.2 General references
11.3 Related links
//
[edit] Sample preparation
The NMR sample is prepared in a thin walled glass tube.
Protein nuclear magnetic resonance is performed on aqueous samples of highly purified protein. Usually the sample consist of between 300 and 600 microlitres with a protein concentration in the range 0.1 – 3 millimolar. The source of the protein can be either natural or produced in an expression system using recombinant DNA techniques through genetic engineering. Recombinantly expressed proteins are usually easier to produce in sufficient quantity, and makes isotopic labelling possible.
The most abundant isotopes of carbon and oxygen, carbon-12 and oxygen-16, have no net nuclear spin, which is the physical property nuclear magnetic resonance spectroscopy exploits. The most abundant isotope of nitrogen, nitrogen-14, has a net nuclear spin of 1; however, it also has a large quadrupolar moment, a property of the atomic nuclei which prevents high-resolution information to be obtained from this isotope. Thus nuclear magnetic resonance of proteins from natural sources is restricted to utilizing nuclear magnetic resonance based solely on protons. However the less common isotopes, carbon-13 and nitrogen-15, have a net nuclear spin of 1/2, a simpler case making them suitable for nuclear magnetic resonance, and therefore labeling the proteins with these compounds opens up possibilities for doing more advanced experiments which also detect or use these nuclei. Isotopic labeling is done by growing the expression host in a growth media enriched with the desired isotopes. Since isotopically-enriched compounds remain expensive, organisms are used which are capable of growing on a defined minimal medium, containing only one carbon-13 source, usually glucose, but occasionally glycerol or methanol, and one nitrogen-15 source such as ammonium chloride or ammonium sulfate . These organisms include organisms such as Escherichia coli, which is the most frequently used type of bacteria, and Pichia pastoris, which is the most frequently used yeast.
The purified protein is usually dissolved in a buffer solution and adjusted to the desired solvent conditions. The NMR sample is prepared in a thin walled glass tube.
[edit] Data collection
Protein NMR utilizes multidimensional nuclear magnetic resonance experiments to obtain information about the protein. Ideally, each distinct nucleus in the molecule experiences a distinct chemical environment and thus has a distinct chemical shift by which it can be recognized. However, in large molecules such as proteins the number of resonances can typically be several thousand and a one-dimensional spectrum inevitably has incidental overlaps. Therefore multidimensional experiments are performed which correlate the frequencies of distinct nuclei. The additional dimensions decrease the chance of overlap and have a larger information content since they correlate signals from nuclei within a specific part of the molecule. Magnetization is transferred into the sample using pulses of electromagnetic (radiofrequency) energy and between nuclei using delays; the process is described with so-called pulse sequences. Pulse sequences allow the experimenter to investigate and select specific types of connections between nuclei. The array of nuclear magnetic resonance experiments used on proteins fall in two main categories — one where magnetization is transferred through the chemical bonds, and one where the transfer is through space, irrespective of the bonding structure. The first category is used to assign the different chemical shifts to a specific nucleus, and the second is primarily used to generate the distance restraints used in the structure calculation, and in the assignment with unlabelled protein.
Depending on the concentration of the sample, on the magnetic field of the spectrometer, and on the type of experiment, a single multidimensional nuclear magnetic resonance experiment on a protein sample may take hours or even several days to obtain suitable signal-to-noise ratio through signal averaging, and to allow for sufficient evolution of magnetization transfer through the various dimensions of the experiment. Other things being equal, higher-dimensional experiments will take longer than lower-dimensional experiments.
Typically the first experiment to be measured with an isotope-labelled protein is a 2D heteronuclear single quantum correlation (HSQC) spectrum where "heteronuclear" refers to nuclei other than 1H. In theory the heteronuclear single quantum correlation has one peak for each H bound to a heteronucleus. Thus in the 15N-HSQC one signal is expected for each amino acid residue with the exception of proline which has no amide-hydrogen due to the cyclic nature of its backbone. Tryptophan and certain other residues with N-containing sidechains also give rise to additional signals. The 15N-HSQC is often referred to as the fingerprint of a protein because each protein has a unique pattern of signal positions. Analysis of the 15N-HSQC allows researchers to evaluate whether the expected number of peaks is present and thus to identify possible problems due to multiple conformations or sample heterogeneity. The relatively quick heteronuclear single quantum correlation experiment helps determine the feasibility of doing subsequent longer, more expensive, and more elaborate experiments. It is not possible to assign peaks to specific atoms from the heteronuclear single quantum correlation alone.
[edit] Resonance assignment
In order to analyze the nuclear magnetic resonance data, it is important to get a resonance assignment for the protein. That is to find out which chemical shift in each dimension corresponds to which atom. Several different types of experiments have been invented to achieve this. The procedure depends on whether the protein is isotopically labelled or not, since a lot of the assignment experiments depend on carbon-13 and nitrogen-15.
Comparison of a COSY and TOCSY 2D spectra for an amino acid like glutamate or methionine. The TOCSY shows off diagonal crosspeaks between all protons in the spectrum, but the COSY only has crosspeaks between neighbours.
[edit] Homonuclear nuclear magnetic resonance
With unlabelled protein the usual procedure is to record a set of two dimensional homonuclear nuclear magnetic resonance experiments through correlation spectroscopy (COSY), of which several types include conventional correlation spectroscopy, total correlation spectroscopy (TOCSY) and nuclear Overhauser effect spectroscopy (NOESY).[1] A two-dimensional nuclear magnetic resonance experiment produces a two-dimensional spectrum. The units of both axes are chemical shifts. The COSY and TOCSY transfer magnetization through the chemical bonds between adjacent protons. The conventional correlation spectroscopy experiment is only able to transfer magnetization between protons on adjacent atoms, whereas in the total correlation spectroscopy experiment the protons are able to relay the magnetization, so it is transferred among all the protons that are connected by adjacent atoms. Thus in a conventional correlation spectroscopy, an alpha proton transfers magnetization to the beta protons, the beta protons transfers to the alpha and gamma protons, if any are present, then the gamma proton transfers to the beta and the delta protons, and the process continues. In total correlation spectroscopy, the alpha and all the other protons are able to transfer magnetization to the beta, gamma, delta, epsilon if they are connected by a continuous chain of protons. The continuous chain of protons are the sidechain of the individual amino acids. Thus these two experiments are used to build so called spin systems, that is build a list of resonances of the chemical shift of the peptide proton, the alpha protons and all the protons from each residue’s sidechain. Which chemical shifts corresponds to which nuclei in the spin system is determined by the conventional correlation spectroscopy connectivities and the fact that different types of protons have characteristic chemical shifts. To connect the different spinsystems in a sequential order, the nuclear Overhauser effect spectroscopy experiment has to be used. Because this experiment transfers magnetization through space, it will show crosspeaks for all protons that are close in space regardless of whether they are in the same spin system or not. The neighbouring residues are inherently close in space, so the assignments can be made by the peaks in the NOESY with other spin systems.
One important problem using homonuclear nuclear magnetic resonance is overlap between peaks. This occurs when different protons have the same or very similar chemical shifts. This problem becomes greater as the protein becomes larger, so homonuclear nuclear magnetic resonance is usually restricted to small proteins or peptides.
[edit] Nitrogen-15 nuclear magnetic resonance
Schematic of an HNCA and HNCOCA for four sequential residues. The nitrogen-15 dimension is perpendicular to the screen. Each window is focused on the nitrogen chemical shift of that amino acid. The sequential assignment is made by matching the alpha carbon chemical shifts. In the HNCA each residue sees the alpha carbon of it self and the preceding residue. The HNCOCA only sees the alpha carbon of the preceding residue.
The process of resonance assignment for a nitrogen-15 labelled sample is similar to the homonuclear case. No experiment can be performed that transfers magnetisation between two spin systems through bonds either. The main difference is the ability to record nitrogen-15 edited three dimensional experiments: TOCSY-N HSQC and NOESY-N-HSQC. These experiments build onto the HSQC experiment, but have an additional proton dimension. It can be visualised as each peak in the HSQC having the TOCSY or NOESY peaks stacked onto it. Thus if the TOCSY peak from an amide proton, HN, has a cross peak to its alpha proton, Halpha, at the coordinates (HN, Halpha) in the TOCSY spectrum, the corresponding peak would be at (HN, Halpha,N) in the TOCSY-N-HSQC. Thus it is possible to resolve overlaps in the proton dimension, if the corresponding nitrogens have chemical shifts distinct from one another.
[edit] Carbon-13 and nitrogen-15 nuclear magnetic resonance
When the protein is labelled with carbon-13 and nitrogen-15 it is possible to record an experiment that transfers magnetisation over the peptide bond, and thus connect different spin systems through bonds. This is usually done using some of the following experiments, HNCO, HNCACO, HNCA,[2] HNCOCA, HNCACB and CBCACONH. All six experiments consist of a HSQC plane expanded with a carbon dimension. In the HNCACO the spectrum contains peaks at the chemical shifts of the carbonyl carbons in the residue of the HSQC peak and the previous one in the sequence. The HNCO only contains the chemical shift from the previous residue, and it is thus possible to assign the carbonyl carbon shifts that corresponds to each HSQC peak and the one previous to that one. Sequential assignment can then be undertaken by matching the shifts of each spin system's own and previous carbons. The HNCA and HNCOCA works similarly, just with the alpha carbons rather than the carbonyls, and the HNCACB and the CBCACONH contains both the alpha carbon and the beta carbon. Usually several of these experiments are required to resolve overlap in the carbon dimension. This procedure is usually less ambiguous than the NOESY based method, since it is based on through bond transfer. In the NOESY-based methods additional peaks that are close in space but not belonging to the sequential residues will appear confusing the assignment process. When the sequential assignment has been made it is usually possible to assign the sidechains using HCCH-TOCSY, which is basically a TOCSY experiment resolved in an additional carbon dimension.
[edit] Restraint generation
In order to make structure calculations a number of experimentially determined restraints have to be generated. These fall into different categories, the most widely used is distance restraints and angle restraints.
[edit] Distance restraints
A crosspeak in a NOESY experiment signifies spatial proximity between the two nuclei in question. Thus each peak can be converted in to a maximum distance between the nuclei, usually between 1,8 and 6 angstroms. The intensity of a noesy peak is proportional to the distance to the minus 6th power, so the distance is determined according to intensity of the peak. The intensity-distance relationship is not exact, so usually a distance range is used.
It is of great importance to assign the noesy peaks to the correct nuclei based on the chemical shifts. If this task is performed manually it is usually very labor intensive, since proteins usually have thousands of noesy peaks. Some computer programs such as CYANA[3] and ARIA[4]/CNS perform this task automatically, coupled to a structure calculation.
To obtain as accurate assignments as possible it is a great advantage to have access to carbon-13 and nitrogen-15 noesy experiments, since they help to resolve overlap in the proton dimension. This leads to faster and more reliable assignments, and in turn to better structures.
[edit] Angle restraints
In addition to distance restraints, restraints on the torsion angles of the chemical bonds, typically the psi and phi angles can be generated. One approach is to use the Karplus equation, to generate angle restraints from coupling constants. Another approach uses the chemical shifts to generate angle restraints. Both methods use the fact that the geometry around the alpha carbon affects the coupling constants and chemical shifts, so given the coupling constants or the chemical shifts, a qualified guess can be made about the torsion angles.
[edit] Orientation restraints
Main article: Residual dipolar coupling
The blue arrows represent the orientation of the N - H bond of selected peptide bonds. By determining the orientation of a sufficient amount of bonds relative to the external magnetic field, the structure of the protein can be determined. From PDB record 1KBH
The analyte molecules in a sample can be partially ordered with respect to the external magnetic field of the spectrometer by manipulating the sample conditions. Common techniques include addition of bacteriophages or bicelles to the sample, or preparation of the sample in a stretched polyacrylamide gel. This creates a local environment that favours certain orientations of nonspherical molecules. Normally in solution NMR the dipolar couplings between nuclei are averaged out because of the fast tumbling of the molecule. The slight overpopulation of one orientation means that a residual dipolar coupling remains to be observed. The dipolar coupling is commonly used in solid state NMR and provides information about the relative orientation of the bond vectors relative to a single global reference frame. Typically the orientation of the N-H vector is probed in a HSQC like experiment. Initially residual dipolar couplings were used for refinement of previously determined structures, but attempts at de novo structure determination have also been made.[5]
[edit] Hydrogen-Deuterium exchange
Main article: Hydrogen-deuterium exchange
NMR spectroscopy is nuclei specific. Thus it can distinguish between hydrogen and deuterium. The amide protons in the protein exchange readily with the solvent, and if the solvent contains a different isotope, typically deuterium, the reaction can be monitored by NMR spectroscopy. How rapidly a given amide exchanges reflects its solvent accessibility. Thus amide exchange rates can give information on which parts of the protein are buried, hydrogen bonded etc. A common application is to compare the exchange of a free form versus a complex. The amides that become protected in the complex, are assumed to be in the interaction interface.
[edit] Structure calculation
Nuclear magnetic resonance structure determination generates an ensemble of structures. The structures will only converge if the data is sufficient to dictate a specific fold. In these structures, it is only the case for a part of the structure. From PDB 1SSU.
The experimentially determined restraints can be used as input for the structure calculation process. Researchers, using computer programs such as CYANA or XPLOR-NIH,[6] attempt to satisfy as many of the restraints as possible, in addition to general properties of proteins such as bond lengths and angles. The algorithms convert the restraints and the general protein properties into energy terms, and thus tries to minimize the energy. The process results in an ensemble of structures that, if the data were sufficient to dictate a certain fold, will converge.
[edit] Dynamics
In addition to structures, nuclear magnetic resonance can yield information on the dynamics of various parts of the protein. This usually involves measuring relaxation times such as T1 and T2 to determine order parameters, correlation times, and chemical exchange rates. NMR relaxation is a consequence of local fluctuating magnetic fields within a molecule. Local fluctuating magnetic fields are generated by molecular motions. In this way measurements of relaxation times can provide information of motions within a molecule on the atomic level. In NMR studies of protein dynamics the nitrogen-15 isotope is the preferred nucleus to study, because its relaxation times are relatively simple to relate to molecular motions, which however requires isotope labeling of the protein. The T1 and T2 relaxation times can be measured using various types of HSQC based experiments. The types of motions, which can be detected, are motions that occur on a time-scale ranging from about 10 picoseconds to about 10 nanoseconds. In addition slower motions, which take place on a time-scale ranging from about 10 microseconds to 100 milliseconds can also be studied. However, since nitrogen atoms are mainly found in the backbone of a protein, the results mainly reflect the motions of the backbone, which is the most rigid part of a protein molecule. Thus, the results obtained from nitrogen-15 relaxation measurements may not be representative for the whole protein. Therefore techniques utilizing relaxation measurements of carbon-13 and deuterium have recently been developed, which enables systematic studies of motions of the amino acid side chains in proteins.
[edit] NMR spectroscopy on large proteins
Traditionally nuclear magnetic resonance spectroscopy has been limited to relatively small proteins or protein domains. This is in part caused by problems resolving overlapping peaks in larger proteins, but this has been alleviated by the introduction of isotope labelling and multidimensional experiments. Another more serious problem is the fact that in large proteins the magnetization relaxes faster, which means there is less time to detect the signal. This in turn causes the peaks to become broader and weaker, and eventually disappear. Two techniques have been introduced to attenuate the relaxation: transverse relaxation optimized spectroscopy (TROSY)[7] and deuteration[8] of proteins. By using these techniques it has been possible to study proteins in complex with the 900 kDa chaperone GroES-GroEL.[9]
[edit] Automation of the process
Structure determination by NMR has traditionally been a time consuming process, requiring interactive analysis of the data by a trained scientist. There has been a considerable interest in automating the process to increase the throughput of structure determination (See structural genomics). The two most time consuming processes are the resonance assignment and the NOE assignment. Several different computer programs have been published that do this processes automatically.[3][1] Efforts have also been made to standardize the structure calculation protocol to make it quicker and more amenable to automation.[10]
Thursday, September 3, 2009
Bioinformatics Practicals
Practical 2
Date: 27-07-2009
Title
"Retrieval of protein sequence of HIV 1 Protease and predicting the length, molecular weight,
amino acid composition"
Objective
Understanding of Protein Primary database and study of retrieval and analyzing a protein
sequence
Introduction
Swissprot
Swiss-Prot is a manually curated biological database of protein sequences. Swiss-Prot was
created in 1986 by Amos Bairoch by the Swiss Institute of Bioinformatics (SIB) and the European
Bioinformatics Institute (EBI). Swiss-Prot strives to provide reliable protein sequences
associated with a high level of annotation (such as the description of the function of a protein,
its domains structure, post-translational modifications, variants, etc.), a minimal level of
redundancy and high level of integration with other databases.
Bioedit
BioEdit is biological sequence alignment software for windows. An intuitive multiple
document interfaces with convenient features makes alignment and manipulation of sequences
relatively easy for the desktop computer. By using Bioedit we can predict the protein sequence
molecular weight, length and amino acid composition.
SwissProt: P04585 (HIV-1 HXB2 POL) 99 amino acids (residues 57 to 155)
EMBL: K03455; AAB50259.1 [EMBL/GenBank/DDBJ]
Pfam: PF00558; UNKNOWN
SCOP: SSF50630 Acid protease
BLOCKS: P04585
Prosite: P04585
ProtoNet: P04585
ProtoMap: P04585
PDB: 1AAQ
Requirements for the analysis
OS: windows/Linux/Mac Os
Internet connection
Softwares Required: MS Office, Swissprot, Bioedit.
Methodology
I. Open the internet browser and use the url www.expasy,org
II. Enter the Swissprot Accession "P04585" of HIV 1 protease
III. Retrieve the Protein sequence in FASTA format
IV. Open the sequence in BIOEDIT software and analyse the length, molecular weight and
amino acid composition
V. Report the result
RESULTS
>Protease (Retropepsin) p15 (EC 3.4.23.16) - Human immunodeficiency virus
type 1 (HXB2 isolate) (HIV-1).
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLV
GPTPVNIIGRNLLTQIGCTLNF
Protein: Protease (Retropepsin) p15 (EC 3.4.23.16) - Human immunodeficiency virus type
1 (HXB2 isolate) (HIV-1).
Length = 99 amino acids
Molecular Weight = 10778.21 Daltons
Amino Acid Number Mol%
Ala A 3 3.03
Cys C 2 2.02
Asp D 4 4.04
Glu E 4 4.04
Phe F 2 2.02
Gly G 13 13.13
His H 1 1.01
Ile I 12 12.12
Lys K 6 6.06
Leu L 12 12.12
Met M 2 2.02
Asn N 3 3.03
Pro P 6 6.06
Gln Q 6 6.06
Arg R 4 4.04
Ser S 1 1.01
Thr T 8 8.08
Val V 7 7.07
Trp W 2 2.02
Tyr Y 1 1.01
Practical 3
Date: 29- 07-2008
Title
"Prediction of protein primary structure of HIV 1 Protease by ProtParam"
Objective
To study the protein primary structure of the protein for the given sequence
Introduction
ProtParam
ProtParam is a tool which allows the computation of various physical and chemical parameters
for a given protein stored in Swiss-Prot or TrEMBL or for a user entered sequence. The
computed parameters include the molecular weight, theoretical pI, amino acid composition,
atomic composition, extinction coefficient, estimated half-life, instability index, aliphatic index
and grand average of hydropathicity
Methodology
I. Open internet browser and use the url http://www.expasy.org/tools/protparam.html
II. Copy and past the given sequence in the text box displayed in protparam tool
III. Click on compute parameters
IV. Report the results
RESULTS
Number of amino acids: 99
Molecular weight: 10778.7
Theoretical pI: 8.83
Total number of negatively charged residues (Asp + Glu): 8
Total number of positively charged residues (Arg + Lys): 10
Atomic composition:
Carbon C 488
Hydrogen H 802
Nitrogen N 130
Oxygen O 135
Sulfur S 4
Formula: C488H802N130O135S4
Total number of atoms: 1559
Practical 4
Date: 30-07-2009
Title
"Prediction of protein Secondary structure of HIV 1 Protease by Chou-Fasman"
Objective
To study the alpha helix, beeta sheets, coils and truns of HIV 1 Protease.
Introduction
Secondary Structure Prediction
Secondary structure in proteins consists of local inter-residue interactions mediated by
hydrogen bonds, or not. The most common secondary structures are alpha helices and beta
sheets. Other helices, such as the 310 helix and ð helix, are calculated to have energetically
favorable hydrogen-bonding patterns but are rarely if ever observed in natural proteins except
at the ends of á helices due to unfavorable backbone packing in the center of the helix.
Secondary structure of protein is mainly study of Alpha helix regions, Beeta sheets, coils and
turns. For predicting the secondary structure we have used an online server called SOPMA.
Chou-Fasman method
The Chou-Fasman method are an empirical technique for the prediction of secondary structures
in proteins, originally developed in the 1970s. The method is based on analyses of the relative
frequencies of each amino acid in alpha helices, beta sheets, and turns based on known protein
structures solved with X-ray crystallography. From these frequencies a set of probability
parameters were derived for the appearance of each amino acid in each secondary structure
type, and these parameters are used to predict the probability that a given sequence of amino
acids would form a helix, a beta strand, or a turn in a protein. The method is at most about 50-
60% accurate in identifying correct secondary structures, which is significantly less accurate
than the GOR method or modern machine learning-based techniques.
http://fasta.bioch.virginia.edu/fasta_www2/fasta_www.cgi?rm=misc1
Methodology
I. Open internet browser and use the url of Chou-Fasman online server
http://fasta.bioch.virginia.edu/fasta_www2/fasta_www.cgi?rm=misc1
II. Copy and paste the given sequence in the text box displayed in Chou-Fasman online tool
III. Click on SUBMIT
IV. Report the results
RESULTS
Practical 5
Date: 04 – 08 - 2008
Title
"Prediction of protein Secondary structure of HIV 1 Protease by SOPMA"
Objective
To study the alpha helix, beeta sheets, coils and truns of HIV 1 Protease.
INTRODUCTION
Secondary Structure Prediction
Secondary structure in proteins consists of local inter-residue interactions mediated by
hydrogen bonds, or not. The most common secondary structures are alpha helices and beta
sheets. Other helices, such as the 310 helix and ð helix, are calculated to have energetically
favorable hydrogen-bonding patterns but are rarely if ever observed in natural proteins except
at the ends of á helices due to unfavorable backbone packing in the center of the helix.
Secondary structure of protein is mainly study of Alpha helix regions, Beeta sheets, coils and
turns. For predicting the secondary structure we have used an online server called SOPMA.
SOPMA
SOPMA (Self-Optimized Prediction Method with Alignment) is an improvement of SOPM
method. These methods are based on the homologue method of Levin et al.. The improvent
takes place in the fact that SOPMA takes into account information from an alignment of
sequences belonging to the same family. SOPMA (Self-Optimized Prediction Method with
Alignment) is an improvement of SOPM method. These methods are based on the homologue
method of Levin et al.. This online server is available with swissprot. Following is the url to get
the server.
http://npsa-pbil.ibcp.fr/cgi-bin/npsa_automat.pl?page=npsa_sopma.html
Methodology
V. Open internet browser and use the url http://npsa-pbil.ibcp.fr/cgibin/
npsa_automat.pl?page=npsa_sopma.html
VI. Copy and paste the given sequence in the text box displayed in SOPMA tool
VII. Click on SUBMIT
VIII. Report the results
RESULTS
Subscribe to:
Posts (Atom)
